PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1193191g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 540aa    MW: 57302.1 Da    PI: 6.938
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1193191g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789e-25176219144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCsr++ +++k+CErHlhrgr rsrk++e
  PDK_30s1193191g001 176 DPEPGRCRRTDGKKWRCSRDAAPDQKYCERHLHRGRPRSRKPVE 219
                         79***************************************998 PP

2QLQ48.13.5e-17112144234
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                         +FT aQ+q+L +Q+l+yK+++a++PvPp+Ll++
  PDK_30s1193191g001 112 PFTSAQWQELQRQALIYKHIIASVPVPPDLLFP 144
                         8*****************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.1E-9111147IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.5E-12112144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.996112147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.724176220IPR014977WRC domain
PfamPF088791.2E-20177219IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
METGVGLGDK RERKEDEESL GLGFGCGSDS ITFAPHQKLI RTAGFPFLSC TTRDGGSVPT  60
STPFLGSGPT LFLNDAYDGG RALQPFPIPF RSPGVAMGVG GSASAAALRA IPFTSAQWQE  120
LQRQALIYKH IIASVPVPPD LLFPSSPPHH LLPNQTVVVG RGSAGAFNLR FSGNTDPEPG  180
RCRRTDGKKW RCSRDAAPDQ KYCERHLHRG RPRSRKPVEV GKTKPITSNA PPPTAVSTNS  240
PTIVTAAAAT TATATAAATT SSSLSKPFPS QSSVFFPKDE LKFPFQPLEP NKEPRCLDWI  300
KGNNEEMESS LQWELMHSKI GLSSSSTPIL QSYDDHLNSS YTAFLNPDFC SLEEDTIGDH  360
REIPRSFIDA WSTENPAAAT TKNGNLTSVP AGGELPLSTL TLSMSGVEEG GDHQIQMGLG  420
VGDTLVKTRP SGWIAPASPL GGPLGEVLQT SNATSPRQGF VADDCRDSGS GGLINCMSIG  480
FHGHAASPQE SPTRLASSPS GVLQKAMVSL SDSSSSSSPT FAAASRSEIA LQWMNQAKQQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008811877.10.0PREDICTED: growth-regulating factor 7-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2255846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.15e-31growth-regulating factor 2